| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190696.1 | internal | 121 | 1-363(+) |
Amino Acid sequence : | |||
| TSAYMAAYFVRNGFRRRDKRYNMLLSLFSNLDKLLSPDGPCHNSLWFAILAFHDALSEQPRDPLVVAAFSLAVHNGGDLSEALSIARRINKQHDISFDELLEPKYMESDELLHEVRSLAA S | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 13,724.406 | ||
| Theoretical pI: | 5.898 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 61.955 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.201 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.231 | ||
| sheet | 0.339 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190696.1 | internal | 121 | 1-363(+) |
Amino Acid sequence : | |||
| TSAYMAAYFVRNGFRRRDKRYNMLLSLFSNLDKLLSPDGPCHNSLWFAILAFHDALSEQPRDPLVVAAFSLAVHNGGDLSEALSIARRINKQHDISFDELLEPKYMESDELLHEVRSLAA S | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 13,724.406 | ||
| Theoretical pI: | 5.898 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 61.955 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.201 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.231 | ||
| sheet | 0.339 | ||