| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190698.1 | internal | 198 | 594-1(-) |
Amino Acid sequence : | |||
| HEDEVENVHTIEVEHVNDIEVENVHEKENEPEDVIPENSNPSDKQDDADEAVAGGGEKWPGWPGESVFRMLVPAQKVGSIIGRKGEYIKKTCEETKARIKILDGPPGTRERAVMVSAKEE PDASLPPAIDGLLRVLRRVVDGLENDSTDPPLSSGGKVSTKLLVPASQAGNLIGKQGATVKSIQEESNCIVRVLLRRS | |||
Physicochemical properties | |||
| Number of amino acids: | 198 | ||
| Molecular weight: | 21,512.834 | ||
| Theoretical pI: | 4.875 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 47.801 | ||
| aromaticity | 0.020 | ||
| GRAVY | -0.601 | ||
Secondary Structure Fraction | |||
| Helix | 0.253 | ||
| turn | 0.273 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190698.1 | internal | 198 | 594-1(-) |
Amino Acid sequence : | |||
| HEDEVENVHTIEVEHVNDIEVENVHEKENEPEDVIPENSNPSDKQDDADEAVAGGGEKWPGWPGESVFRMLVPAQKVGSIIGRKGEYIKKTCEETKARIKILDGPPGTRERAVMVSAKEE PDASLPPAIDGLLRVLRRVVDGLENDSTDPPLSSGGKVSTKLLVPASQAGNLIGKQGATVKSIQEESNCIVRVLLRRS | |||
Physicochemical properties | |||
| Number of amino acids: | 198 | ||
| Molecular weight: | 21,512.834 | ||
| Theoretical pI: | 4.875 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 47.801 | ||
| aromaticity | 0.020 | ||
| GRAVY | -0.601 | ||
Secondary Structure Fraction | |||
| Helix | 0.253 | ||
| turn | 0.273 | ||
| sheet | 0.258 | ||