| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190704.1 | 3prime_partial | 206 | 618-1(-) |
Amino Acid sequence : | |||
| MSLSLRIGSKTLTTWFMVGLDLGEWLRHWWASVATFLAPSVEYEYMTRGNLENHLFRRYTSSLTWENRIKIAVGAAKGLAFLHGEDKPVIYRDFKTSNILLDSDYNAKLSDFGLAKDGPE GDNTHVSTRIMGTHGYAAPEYIMTGHLTTMNDVYGFGVVLLEFLTGRRAMDKKRPAREQNLVDWAKPYLKDHHKLDNIMDPRLRGS | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 11,948.863 | ||
| Theoretical pI: | 10.396 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 51.790 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.145 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.248 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190704.1 | 3prime_partial | 105 | 350-664(+) |
Amino Acid sequence : | |||
| MTGLSSPWRNARPFAAPTAIFILFSHVNELVYRRKRWFSRLPLVIYSYSTEGARKVATLAHQCLSHSPKSRPTMNHVVKVLEPILKLKDIPTGPFVYVAPTQESK | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,948.863 | ||
| Theoretical pI: | 10.396 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 51.790 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.145 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.248 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190704.1 | 3prime_partial | 206 | 618-1(-) |
Amino Acid sequence : | |||
| MSLSLRIGSKTLTTWFMVGLDLGEWLRHWWASVATFLAPSVEYEYMTRGNLENHLFRRYTSSLTWENRIKIAVGAAKGLAFLHGEDKPVIYRDFKTSNILLDSDYNAKLSDFGLAKDGPE GDNTHVSTRIMGTHGYAAPEYIMTGHLTTMNDVYGFGVVLLEFLTGRRAMDKKRPAREQNLVDWAKPYLKDHHKLDNIMDPRLRGS | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 11,948.863 | ||
| Theoretical pI: | 10.396 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 51.790 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.145 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.248 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190704.1 | 3prime_partial | 105 | 350-664(+) |
Amino Acid sequence : | |||
| MTGLSSPWRNARPFAAPTAIFILFSHVNELVYRRKRWFSRLPLVIYSYSTEGARKVATLAHQCLSHSPKSRPTMNHVVKVLEPILKLKDIPTGPFVYVAPTQESK | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,948.863 | ||
| Theoretical pI: | 10.396 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 51.790 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.145 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.248 | ||
| sheet | 0.229 | ||