| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190708.1 | internal | 147 | 1-441(+) |
Amino Acid sequence : | |||
| TLALAEQVPLIIIQNNDGEKFFKPNVEPDQIASWVKDFKDGNVKAFRKSEPIPEANNEPVKVVVADTLQDMFFKSGKNVLLEFYAPWCGHCKKLAPILDEVALSFANDADVVIAKIDATA NDIPAGAFDVKGYPTLYLRSSTGKQLQ | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 16,196.336 | ||
| Theoretical pI: | 4.982 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 28.463 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.139 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.218 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190708.1 | internal | 147 | 1-441(+) |
Amino Acid sequence : | |||
| TLALAEQVPLIIIQNNDGEKFFKPNVEPDQIASWVKDFKDGNVKAFRKSEPIPEANNEPVKVVVADTLQDMFFKSGKNVLLEFYAPWCGHCKKLAPILDEVALSFANDADVVIAKIDATA NDIPAGAFDVKGYPTLYLRSSTGKQLQ | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 16,196.336 | ||
| Theoretical pI: | 4.982 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 28.463 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.139 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.218 | ||
| sheet | 0.252 | ||