| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190713.1 | 5prime_partial | 115 | 1-348(+) |
Amino Acid sequence : | |||
| AVGRWGLTGKAQVMPMKNLSDGQRSRVIFAWLAWRQPQMLLLDEPTNHLDIETIDSLAEALNEWDGGMVLVSHDFRLINQVAKEIWVCENQAVTRWEGDIMEFKQHLRARAGLFD* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 12,415.156 | ||
| Theoretical pI: | 8.561 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 61.474 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.310 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.266 | ||
| sheet | 0.211 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190713.1 | complete | 109 | 495-166(-) |
Amino Acid sequence : | |||
| MLSCDLLPRFDRISSFITTHRHRTSSSEPIKSKVSEEDWLSPCSDAPPGSVKQTSPSPQVLLELHDISLPPRHSLIFTHPYLLRHLVYEPKIVAHKNHAAIPFVQRLCQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 12,415.156 | ||
| Theoretical pI: | 8.561 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 61.474 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.310 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.266 | ||
| sheet | 0.211 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190713.1 | 5prime_partial | 115 | 1-348(+) |
Amino Acid sequence : | |||
| AVGRWGLTGKAQVMPMKNLSDGQRSRVIFAWLAWRQPQMLLLDEPTNHLDIETIDSLAEALNEWDGGMVLVSHDFRLINQVAKEIWVCENQAVTRWEGDIMEFKQHLRARAGLFD* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 12,415.156 | ||
| Theoretical pI: | 8.561 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 61.474 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.310 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.266 | ||
| sheet | 0.211 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190713.1 | complete | 109 | 495-166(-) |
Amino Acid sequence : | |||
| MLSCDLLPRFDRISSFITTHRHRTSSSEPIKSKVSEEDWLSPCSDAPPGSVKQTSPSPQVLLELHDISLPPRHSLIFTHPYLLRHLVYEPKIVAHKNHAAIPFVQRLCQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 12,415.156 | ||
| Theoretical pI: | 8.561 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 61.474 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.310 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.266 | ||
| sheet | 0.211 | ||