| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190717.1 | 5prime_partial | 169 | 524-15(-) |
Amino Acid sequence : | |||
| QAARNRQGIFTDVDIRFPDQESVLEDTEKVCSSNDIEDTKAVLKLLPICLACLPFAVAYSQSTTLFTKQGATMDRRISPNFQIPAAALQAFTPVSIILFVPFYEHIVIPIARAISHKPSG ISSLQRIGTGLFLGIVCMIIAAFTERKRLETASEYGLLDLPDETVPMSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 169 | ||
| Molecular weight: | 18,574.336 | ||
| Theoretical pI: | 5.367 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 57.547 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.243 | ||
Secondary Structure Fraction | |||
| Helix | 0.337 | ||
| turn | 0.201 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190717.1 | 5prime_partial | 169 | 524-15(-) |
Amino Acid sequence : | |||
| QAARNRQGIFTDVDIRFPDQESVLEDTEKVCSSNDIEDTKAVLKLLPICLACLPFAVAYSQSTTLFTKQGATMDRRISPNFQIPAAALQAFTPVSIILFVPFYEHIVIPIARAISHKPSG ISSLQRIGTGLFLGIVCMIIAAFTERKRLETASEYGLLDLPDETVPMSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 169 | ||
| Molecular weight: | 18,574.336 | ||
| Theoretical pI: | 5.367 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 57.547 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.243 | ||
Secondary Structure Fraction | |||
| Helix | 0.337 | ||
| turn | 0.201 | ||
| sheet | 0.260 | ||