| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190730.1 | internal | 106 | 318-1(-) |
Amino Acid sequence : | |||
| LYLEEKYPERPWLPQDVQAKALNYQAANIIFANIQPFQNISTTAYLVEKLGEDETVYWVQRQIKIGLFALEKLLEKHSGKYATGDEVFWADLFLPPQIDIAVTWFN | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 12,363.951 | ||
| Theoretical pI: | 4.725 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 30940 | ||
| Instability index: | 38.889 | ||
| aromaticity | 0.151 | ||
| GRAVY | -0.190 | ||
Secondary Structure Fraction | |||
| Helix | 0.396 | ||
| turn | 0.160 | ||
| sheet | 0.292 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190730.1 | internal | 106 | 318-1(-) |
Amino Acid sequence : | |||
| LYLEEKYPERPWLPQDVQAKALNYQAANIIFANIQPFQNISTTAYLVEKLGEDETVYWVQRQIKIGLFALEKLLEKHSGKYATGDEVFWADLFLPPQIDIAVTWFN | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 12,363.951 | ||
| Theoretical pI: | 4.725 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 30940 | ||
| Instability index: | 38.889 | ||
| aromaticity | 0.151 | ||
| GRAVY | -0.190 | ||
Secondary Structure Fraction | |||
| Helix | 0.396 | ||
| turn | 0.160 | ||
| sheet | 0.292 | ||