| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190731.1 | internal | 174 | 1-522(+) |
Amino Acid sequence : | |||
| TGSGKGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSLLEHTDVVVLLDNEAIYDICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPR IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLM | |||
Physicochemical properties | |||
| Number of amino acids: | 174 | ||
| Molecular weight: | 19,408.051 | ||
| Theoretical pI: | 5.919 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13410 13660 | ||
| Instability index: | 45.556 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.030 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.253 | ||
| sheet | 0.247 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190731.1 | internal | 174 | 1-522(+) |
Amino Acid sequence : | |||
| TGSGKGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSLLEHTDVVVLLDNEAIYDICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPR IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLM | |||
Physicochemical properties | |||
| Number of amino acids: | 174 | ||
| Molecular weight: | 19,408.051 | ||
| Theoretical pI: | 5.919 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13410 13660 | ||
| Instability index: | 45.556 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.030 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.253 | ||
| sheet | 0.247 | ||