| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190736.1 | internal | 254 | 2-763(+) |
Amino Acid sequence : | |||
| LFLLTWEREIGGLIAKAMEKVGKEGVITIQDGKTLFNELEVVEGMKLDRGYISPYFITNQKTQKCELDDPLILIHEKKISSINSIVKVLELALKRQRPLLIVAEDVESDALATLILNKLR AGIKVCAVKAPGFGENRKSNMQDLAVLTGGQVITEELGMNLDDVDLDMLGSCKKVTISKDDTVILDGAGEKKSIEERTDQIRSAIELSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAE VGEKKDRVTDALNA | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 14,522.663 | ||
| Theoretical pI: | 11.141 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 59.856 | ||
| aromaticity | 0.115 | ||
| GRAVY | 0.236 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.313 | ||
| sheet | 0.214 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190736.1 | complete | 131 | 582-187(-) |
Amino Acid sequence : | |||
| MDFFSPAPSRITVSSLEIVTFLHDPSISRSTSSKFIPSSSVMTWPPVKTARSCMFDFLFSPNPGAFTAQTLIPARSLLRIRVASASLSTSSATIRSGLCLFKANSRTLTMEFMLEIFFSW IRIRGSSNSHF* | |||
Physicochemical properties | |||
| Number of amino acids: | 131 | ||
| Molecular weight: | 14,522.663 | ||
| Theoretical pI: | 11.141 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 59.856 | ||
| aromaticity | 0.115 | ||
| GRAVY | 0.236 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.313 | ||
| sheet | 0.214 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190736.1 | internal | 254 | 2-763(+) |
Amino Acid sequence : | |||
| LFLLTWEREIGGLIAKAMEKVGKEGVITIQDGKTLFNELEVVEGMKLDRGYISPYFITNQKTQKCELDDPLILIHEKKISSINSIVKVLELALKRQRPLLIVAEDVESDALATLILNKLR AGIKVCAVKAPGFGENRKSNMQDLAVLTGGQVITEELGMNLDDVDLDMLGSCKKVTISKDDTVILDGAGEKKSIEERTDQIRSAIELSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAE VGEKKDRVTDALNA | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 14,522.663 | ||
| Theoretical pI: | 11.141 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 59.856 | ||
| aromaticity | 0.115 | ||
| GRAVY | 0.236 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.313 | ||
| sheet | 0.214 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190736.1 | complete | 131 | 582-187(-) |
Amino Acid sequence : | |||
| MDFFSPAPSRITVSSLEIVTFLHDPSISRSTSSKFIPSSSVMTWPPVKTARSCMFDFLFSPNPGAFTAQTLIPARSLLRIRVASASLSTSSATIRSGLCLFKANSRTLTMEFMLEIFFSW IRIRGSSNSHF* | |||
Physicochemical properties | |||
| Number of amino acids: | 131 | ||
| Molecular weight: | 14,522.663 | ||
| Theoretical pI: | 11.141 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 59.856 | ||
| aromaticity | 0.115 | ||
| GRAVY | 0.236 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.313 | ||
| sheet | 0.214 | ||