| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190742.1 | 5prime_partial | 180 | 1-543(+) |
Amino Acid sequence : | |||
| LALEKGDEELAREAQKRRKSYADNASSLRAQLDQQKSVVENLVSNTRLLESKIQEAKSKKETLKARAQSAKTATKVSEMLGNVNTSSALSAFEKMEEKVLAMESQAEALNQLTGDELEGK FALLETSSVDDDLASLKKELSGSTKKGELPPGRPVAAALKFQDPEIENELNELRQKAKDY* | |||
Physicochemical properties | |||
| Number of amino acids: | 180 | ||
| Molecular weight: | 19,782.998 | ||
| Theoretical pI: | 5.351 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 38.518 | ||
| aromaticity | 0.028 | ||
| GRAVY | -0.762 | ||
Secondary Structure Fraction | |||
| Helix | 0.217 | ||
| turn | 0.206 | ||
| sheet | 0.400 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190742.1 | 5prime_partial | 180 | 1-543(+) |
Amino Acid sequence : | |||
| LALEKGDEELAREAQKRRKSYADNASSLRAQLDQQKSVVENLVSNTRLLESKIQEAKSKKETLKARAQSAKTATKVSEMLGNVNTSSALSAFEKMEEKVLAMESQAEALNQLTGDELEGK FALLETSSVDDDLASLKKELSGSTKKGELPPGRPVAAALKFQDPEIENELNELRQKAKDY* | |||
Physicochemical properties | |||
| Number of amino acids: | 180 | ||
| Molecular weight: | 19,782.998 | ||
| Theoretical pI: | 5.351 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 38.518 | ||
| aromaticity | 0.028 | ||
| GRAVY | -0.762 | ||
Secondary Structure Fraction | |||
| Helix | 0.217 | ||
| turn | 0.206 | ||
| sheet | 0.400 | ||