| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190746.1 | internal | 99 | 1-297(+) |
Amino Acid sequence : | |||
| TAFLMSRQLAELDSIKPPPYGTIQAACEVYNESGITGFWKGIAPTLIMVCNPSIQFMIYESLLKRLRSKRSAKKRGSTDIKALEIFLVGAIAKLGATVC | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 10,838.733 | ||
| Theoretical pI: | 9.511 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 43.588 | ||
| aromaticity | 0.081 | ||
| GRAVY | 0.205 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.222 | ||
| sheet | 0.283 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190746.1 | internal | 99 | 1-297(+) |
Amino Acid sequence : | |||
| TAFLMSRQLAELDSIKPPPYGTIQAACEVYNESGITGFWKGIAPTLIMVCNPSIQFMIYESLLKRLRSKRSAKKRGSTDIKALEIFLVGAIAKLGATVC | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 10,838.733 | ||
| Theoretical pI: | 9.511 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 43.588 | ||
| aromaticity | 0.081 | ||
| GRAVY | 0.205 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.222 | ||
| sheet | 0.283 | ||