| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190748.1 | 3prime_partial | 216 | 650-3(-) |
Amino Acid sequence : | |||
| MHLVIYSKDDLDKSEKPGAKQVSGYSKIQNRNSISFPGQPCDSESLQILVRAVPIKQGHKLRFVWPITPGIHHYKEGPSRYLGHLIGHEGEGSLFYILKKLGWATRLSAGESDWTNEFSF FKVSIDLTDAGQEHLQDIVALLFKYIHLLQQSGLCQWIFDELAAICQTSFHYQDKIRPIDYVVNVALNMQFYPPKDWLVGSSLPSKYNPEKIQSAL | |||
Physicochemical properties | |||
| Number of amino acids: | 216 | ||
| Molecular weight: | 24,592.835 | ||
| Theoretical pI: | 7.119 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42400 42525 | ||
| Instability index: | 43.538 | ||
| aromaticity | 0.116 | ||
| GRAVY | -0.278 | ||
Secondary Structure Fraction | |||
| Helix | 0.352 | ||
| turn | 0.245 | ||
| sheet | 0.208 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190748.1 | 3prime_partial | 216 | 650-3(-) |
Amino Acid sequence : | |||
| MHLVIYSKDDLDKSEKPGAKQVSGYSKIQNRNSISFPGQPCDSESLQILVRAVPIKQGHKLRFVWPITPGIHHYKEGPSRYLGHLIGHEGEGSLFYILKKLGWATRLSAGESDWTNEFSF FKVSIDLTDAGQEHLQDIVALLFKYIHLLQQSGLCQWIFDELAAICQTSFHYQDKIRPIDYVVNVALNMQFYPPKDWLVGSSLPSKYNPEKIQSAL | |||
Physicochemical properties | |||
| Number of amino acids: | 216 | ||
| Molecular weight: | 24,592.835 | ||
| Theoretical pI: | 7.119 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42400 42525 | ||
| Instability index: | 43.538 | ||
| aromaticity | 0.116 | ||
| GRAVY | -0.278 | ||
Secondary Structure Fraction | |||
| Helix | 0.352 | ||
| turn | 0.245 | ||
| sheet | 0.208 | ||