| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190757.1 | internal | 230 | 3-692(+) |
Amino Acid sequence : | |||
| QFGKQISTRDAALSTAEQQIKSLQLKFDSAFSNHQSEKEAWERSLQNVEETWRLRCEALERQNEETSSQNLEKEVEKLKLQCKKLKEEQSTFHDLADKMMEEKDKEISRLLDDIENLRQL LDSRPSVEYSEDQTALHKQEPSNSNTSAAEQQILILARQQAQREEELAQTQRHILALQEEIEELEHENRLHRQQEAMLKEELRNMERTQKREGLDLTYLKNVILKLLETV | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 27,168.992 | ||
| Theoretical pI: | 5.046 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 70.034 | ||
| aromaticity | 0.035 | ||
| GRAVY | -1.077 | ||
Secondary Structure Fraction | |||
| Helix | 0.235 | ||
| turn | 0.135 | ||
| sheet | 0.387 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190757.1 | internal | 230 | 3-692(+) |
Amino Acid sequence : | |||
| QFGKQISTRDAALSTAEQQIKSLQLKFDSAFSNHQSEKEAWERSLQNVEETWRLRCEALERQNEETSSQNLEKEVEKLKLQCKKLKEEQSTFHDLADKMMEEKDKEISRLLDDIENLRQL LDSRPSVEYSEDQTALHKQEPSNSNTSAAEQQILILARQQAQREEELAQTQRHILALQEEIEELEHENRLHRQQEAMLKEELRNMERTQKREGLDLTYLKNVILKLLETV | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 27,168.992 | ||
| Theoretical pI: | 5.046 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 70.034 | ||
| aromaticity | 0.035 | ||
| GRAVY | -1.077 | ||
Secondary Structure Fraction | |||
| Helix | 0.235 | ||
| turn | 0.135 | ||
| sheet | 0.387 | ||