| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190764.1 | internal | 114 | 2-343(+) |
Amino Acid sequence : | |||
| HLKGSKHFREVFSELVQGGHGFLVMMKRKDDNDDADNDLDDDEPRPVDTEGRVEKYIGVKVKVSFTGQGETQSMKQLSGGQKTVVALTLIFAIQRCDPAPFYLFDEIDAALDPQ | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 12,743.159 | ||
| Theoretical pI: | 4.818 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 31.725 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.539 | ||
Secondary Structure Fraction | |||
| Helix | 0.281 | ||
| turn | 0.193 | ||
| sheet | 0.219 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190764.1 | internal | 114 | 2-343(+) |
Amino Acid sequence : | |||
| HLKGSKHFREVFSELVQGGHGFLVMMKRKDDNDDADNDLDDDEPRPVDTEGRVEKYIGVKVKVSFTGQGETQSMKQLSGGQKTVVALTLIFAIQRCDPAPFYLFDEIDAALDPQ | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 12,743.159 | ||
| Theoretical pI: | 4.818 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 31.725 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.539 | ||
Secondary Structure Fraction | |||
| Helix | 0.281 | ||
| turn | 0.193 | ||
| sheet | 0.219 | ||