Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ190768.1 | 5prime_partial | 258 | 3-779(+) |
Amino Acid sequence : | |||
YQQKNTPETETDTRSSQLEEKNDSSNMGEVVIPEKWKGQIEKDLPRTFPGHPALDEDGRNALRRLLTAYARHNPCVGYCQAVNFFAGLLLLLMSEENAFWTLVGILDDYFDGYYSEEMIE SQVDQLVLEELMREKFPKLVNHLDYLGVQVAWVTGPWFLTIYMNMLPWESVLRVWDVILFEGNRVMLFRTALALMELYGPAIVTTKDAGDAVTLLQSLAGSTFDSSQLVLTACMGYQNVT EVRLQELRNKHRPTVRLH* | |||
Physicochemical properties | |||
Number of amino acids: | 258 | ||
Molecular weight: | 29,572.453 | ||
Theoretical pI: | 4.892 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 47900 48025 | ||
Instability index: | 51.643 | ||
aromaticity | 0.101 | ||
GRAVY | -0.201 | ||
Secondary Structure Fraction | |||
Helix | 0.345 | ||
turn | 0.194 | ||
sheet | 0.310 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ190768.1 | 5prime_partial | 258 | 3-779(+) |
Amino Acid sequence : | |||
YQQKNTPETETDTRSSQLEEKNDSSNMGEVVIPEKWKGQIEKDLPRTFPGHPALDEDGRNALRRLLTAYARHNPCVGYCQAVNFFAGLLLLLMSEENAFWTLVGILDDYFDGYYSEEMIE SQVDQLVLEELMREKFPKLVNHLDYLGVQVAWVTGPWFLTIYMNMLPWESVLRVWDVILFEGNRVMLFRTALALMELYGPAIVTTKDAGDAVTLLQSLAGSTFDSSQLVLTACMGYQNVT EVRLQELRNKHRPTVRLH* | |||
Physicochemical properties | |||
Number of amino acids: | 258 | ||
Molecular weight: | 29,572.453 | ||
Theoretical pI: | 4.892 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 47900 48025 | ||
Instability index: | 51.643 | ||
aromaticity | 0.101 | ||
GRAVY | -0.201 | ||
Secondary Structure Fraction | |||
Helix | 0.345 | ||
turn | 0.194 | ||
sheet | 0.310 |