| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190770.1 | 5prime_partial | 126 | 2-382(+) |
Amino Acid sequence : | |||
| LGCISTGAERKEAAESTLLAYKSAQDIALADLAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDVADEGGDEIKESSKRES GEGGQQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 11,108.429 | ||
| Theoretical pI: | 9.164 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 99.390 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.364 | ||
Secondary Structure Fraction | |||
| Helix | 0.225 | ||
| turn | 0.373 | ||
| sheet | 0.176 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190770.1 | 5prime_partial | 102 | 459-151(-) |
Amino Acid sequence : | |||
| VPHIRYLSPPGLTIKENTSSTPMKTHHCCPPSPDSRFEDSFISSPPSSATSDVQRVRLSRRSCMISVLSLYDSSPSVSSSEIASSKACFARLHARSGELRIS* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,108.429 | ||
| Theoretical pI: | 9.164 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 99.390 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.364 | ||
Secondary Structure Fraction | |||
| Helix | 0.225 | ||
| turn | 0.373 | ||
| sheet | 0.176 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190770.1 | 5prime_partial | 126 | 2-382(+) |
Amino Acid sequence : | |||
| LGCISTGAERKEAAESTLLAYKSAQDIALADLAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDVADEGGDEIKESSKRES GEGGQQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 11,108.429 | ||
| Theoretical pI: | 9.164 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 99.390 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.364 | ||
Secondary Structure Fraction | |||
| Helix | 0.225 | ||
| turn | 0.373 | ||
| sheet | 0.176 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190770.1 | 5prime_partial | 102 | 459-151(-) |
Amino Acid sequence : | |||
| VPHIRYLSPPGLTIKENTSSTPMKTHHCCPPSPDSRFEDSFISSPPSSATSDVQRVRLSRRSCMISVLSLYDSSPSVSSSEIASSKACFARLHARSGELRIS* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,108.429 | ||
| Theoretical pI: | 9.164 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 99.390 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.364 | ||
Secondary Structure Fraction | |||
| Helix | 0.225 | ||
| turn | 0.373 | ||
| sheet | 0.176 | ||