| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190780.1 | internal | 132 | 3-398(+) |
Amino Acid sequence : | |||
| IFRKAQQCKERHICLMDRSSGEGADSADDSGSSQPYPSTLPGIPKGSARQLFQRLQGPMEEETLKSHFEKIIMIGQKQHYRKSHNDNQDPKQFQRPHSSHAIALSQVCPNNPNGGPVLTP LGLCDVSTSGPD | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 14,522.081 | ||
| Theoretical pI: | 7.890 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 49.574 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.874 | ||
Secondary Structure Fraction | |||
| Helix | 0.189 | ||
| turn | 0.326 | ||
| sheet | 0.182 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190780.1 | internal | 132 | 3-398(+) |
Amino Acid sequence : | |||
| IFRKAQQCKERHICLMDRSSGEGADSADDSGSSQPYPSTLPGIPKGSARQLFQRLQGPMEEETLKSHFEKIIMIGQKQHYRKSHNDNQDPKQFQRPHSSHAIALSQVCPNNPNGGPVLTP LGLCDVSTSGPD | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 14,522.081 | ||
| Theoretical pI: | 7.890 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 49.574 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.874 | ||
Secondary Structure Fraction | |||
| Helix | 0.189 | ||
| turn | 0.326 | ||
| sheet | 0.182 | ||