| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190782.1 | 3prime_partial | 220 | 37-696(+) |
Amino Acid sequence : | |||
| MPRYMPDRFIAPPTFDQSHPQERNITYGNRDVRNTDRAFDGSLPTSPSPRGGPPSITDDVSSDNVWPEEKMRDKSVAAIKEFYSARDEKEVALCIKDLNAPRFYPSMISIWITDSFERKD MERDLLSKLLINLTKPQDAMISEDQLIKGFENVLAVLEDAVNDAPRAAEFLGRIFAKIILENVVSLSDVGRLIYESGRREKQLVEIRLAAEVLGSIFDII | |||
Physicochemical properties | |||
| Number of amino acids: | 220 | ||
| Molecular weight: | 12,623.438 | ||
| Theoretical pI: | 9.352 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5875 | ||
| Instability index: | 49.941 | ||
| aromaticity | 0.028 | ||
| GRAVY | 0.472 | ||
Secondary Structure Fraction | |||
| Helix | 0.394 | ||
| turn | 0.165 | ||
| sheet | 0.339 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190782.1 | 5prime_partial | 109 | 2-331(+) |
Amino Acid sequence : | |||
| PERVLMFKERILCQGICLTGSLRPQLLINLILRNGILPTGIEMLEIQIVLLMDLCPLHLLLEVDHLVLPMMFLQIMCGRKRKCVISQWLQSKNSTVQEMRRKLLCASRI* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 12,623.438 | ||
| Theoretical pI: | 9.352 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5875 | ||
| Instability index: | 49.941 | ||
| aromaticity | 0.028 | ||
| GRAVY | 0.472 | ||
Secondary Structure Fraction | |||
| Helix | 0.394 | ||
| turn | 0.165 | ||
| sheet | 0.339 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190782.1 | 3prime_partial | 220 | 37-696(+) |
Amino Acid sequence : | |||
| MPRYMPDRFIAPPTFDQSHPQERNITYGNRDVRNTDRAFDGSLPTSPSPRGGPPSITDDVSSDNVWPEEKMRDKSVAAIKEFYSARDEKEVALCIKDLNAPRFYPSMISIWITDSFERKD MERDLLSKLLINLTKPQDAMISEDQLIKGFENVLAVLEDAVNDAPRAAEFLGRIFAKIILENVVSLSDVGRLIYESGRREKQLVEIRLAAEVLGSIFDII | |||
Physicochemical properties | |||
| Number of amino acids: | 220 | ||
| Molecular weight: | 12,623.438 | ||
| Theoretical pI: | 9.352 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5875 | ||
| Instability index: | 49.941 | ||
| aromaticity | 0.028 | ||
| GRAVY | 0.472 | ||
Secondary Structure Fraction | |||
| Helix | 0.394 | ||
| turn | 0.165 | ||
| sheet | 0.339 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190782.1 | 5prime_partial | 109 | 2-331(+) |
Amino Acid sequence : | |||
| PERVLMFKERILCQGICLTGSLRPQLLINLILRNGILPTGIEMLEIQIVLLMDLCPLHLLLEVDHLVLPMMFLQIMCGRKRKCVISQWLQSKNSTVQEMRRKLLCASRI* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 12,623.438 | ||
| Theoretical pI: | 9.352 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5875 | ||
| Instability index: | 49.941 | ||
| aromaticity | 0.028 | ||
| GRAVY | 0.472 | ||
Secondary Structure Fraction | |||
| Helix | 0.394 | ||
| turn | 0.165 | ||
| sheet | 0.339 | ||