| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190783.1 | internal | 141 | 3-425(+) |
Amino Acid sequence : | |||
| ENDLPCVDIFVCTADPNIEPPILVVNTVLSVLAYDYPPEKLAVYLSDDAGSYITFYALLEASAFANHWLPYCKKFKVQPRSPEPYFRSESGQLEAGQAQQFASIKKLYEDMKNRIELAKK LERVSKSALIEHTGFSDWDSY | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 16,018.981 | ||
| Theoretical pI: | 4.885 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24535 | ||
| Instability index: | 51.143 | ||
| aromaticity | 0.128 | ||
| GRAVY | -0.262 | ||
Secondary Structure Fraction | |||
| Helix | 0.340 | ||
| turn | 0.220 | ||
| sheet | 0.277 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190783.1 | internal | 141 | 3-425(+) |
Amino Acid sequence : | |||
| ENDLPCVDIFVCTADPNIEPPILVVNTVLSVLAYDYPPEKLAVYLSDDAGSYITFYALLEASAFANHWLPYCKKFKVQPRSPEPYFRSESGQLEAGQAQQFASIKKLYEDMKNRIELAKK LERVSKSALIEHTGFSDWDSY | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 16,018.981 | ||
| Theoretical pI: | 4.885 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24535 | ||
| Instability index: | 51.143 | ||
| aromaticity | 0.128 | ||
| GRAVY | -0.262 | ||
Secondary Structure Fraction | |||
| Helix | 0.340 | ||
| turn | 0.220 | ||
| sheet | 0.277 | ||