| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190790.1 | internal | 182 | 3-548(+) |
Amino Acid sequence : | |||
| STIWIGLVRPYVHKILVVIEPLLIDEDYYARVEGREIISNLSKAAGLATMIAAMRPDIDNIDEYVRNTTARAFSVVASALGIPALLPFLKAVCQSKKSWQARHTGIKIVQQIAILIGCAV LPHLRSLVEIIEHGLNDENQKVRTITALSLAALAEAAAPYGIESFDSVLKPLWKGIRSHRGK | |||
Physicochemical properties | |||
| Number of amino acids: | 182 | ||
| Molecular weight: | 19,987.182 | ||
| Theoretical pI: | 9.143 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
| Instability index: | 40.273 | ||
| aromaticity | 0.060 | ||
| GRAVY | 0.256 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.192 | ||
| sheet | 0.297 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190790.1 | internal | 182 | 3-548(+) |
Amino Acid sequence : | |||
| STIWIGLVRPYVHKILVVIEPLLIDEDYYARVEGREIISNLSKAAGLATMIAAMRPDIDNIDEYVRNTTARAFSVVASALGIPALLPFLKAVCQSKKSWQARHTGIKIVQQIAILIGCAV LPHLRSLVEIIEHGLNDENQKVRTITALSLAALAEAAAPYGIESFDSVLKPLWKGIRSHRGK | |||
Physicochemical properties | |||
| Number of amino acids: | 182 | ||
| Molecular weight: | 19,987.182 | ||
| Theoretical pI: | 9.143 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
| Instability index: | 40.273 | ||
| aromaticity | 0.060 | ||
| GRAVY | 0.256 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.192 | ||
| sheet | 0.297 | ||