| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190791.1 | 3prime_partial | 153 | 460-2(-) |
Amino Acid sequence : | |||
| MGDNYFPKVSPQGDAMFLPGTRYLRLIKTDYYGNPQSNSIGRAVISNAVQMKYGGVQVDFESVLKFRVAAGDSPDTGSGIAFFIAPENYEIPPNSTGDNYGIFDPTRTTTSHVFAVVFNT QEKTVGINIESPTPRKSMLVNGLIGNDVKAHIK | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 16,669.592 | ||
| Theoretical pI: | 6.722 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10430 | ||
| Instability index: | 31.750 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.280 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.314 | ||
| sheet | 0.157 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190791.1 | 3prime_partial | 153 | 460-2(-) |
Amino Acid sequence : | |||
| MGDNYFPKVSPQGDAMFLPGTRYLRLIKTDYYGNPQSNSIGRAVISNAVQMKYGGVQVDFESVLKFRVAAGDSPDTGSGIAFFIAPENYEIPPNSTGDNYGIFDPTRTTTSHVFAVVFNT QEKTVGINIESPTPRKSMLVNGLIGNDVKAHIK | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 16,669.592 | ||
| Theoretical pI: | 6.722 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10430 | ||
| Instability index: | 31.750 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.280 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.314 | ||
| sheet | 0.157 | ||