| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190794.1 | 3prime_partial | 217 | 53-703(+) |
Amino Acid sequence : | |||
| MEKVGKEGVITIQDGKTLFNELEVVEGMKLDRGYISPYFITNQKTQKCELDDPLILIHEKKISSINSIVKVLELALKRQRPLLIVAEDVESDALATLILNKLRAGIKVCAVKAPGFGENR KSNMQDLAVLTGGQVITEELGMNLDDVDLDMLGSCKKVTISKDDTVILDGAGEKKSIEERTDQITSAIELSTSDYDKEKLQERLAKLSRWCSCAKDW | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 14,591.772 | ||
| Theoretical pI: | 11.380 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 60.226 | ||
| aromaticity | 0.115 | ||
| GRAVY | 0.208 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.305 | ||
| sheet | 0.214 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190794.1 | complete | 131 | 582-187(-) |
Amino Acid sequence : | |||
| MDFFSPAPSRITVSSLEIVTFLHDPSISRSTSSKFIPSSSVMTWPPVKTARSCMFDFLFSPNPGAFTAQTLIPARSLLRIRVASASLSTSSATIRRGLCLFKANSRTLTMEFMLEIFFSW IRIRGSSNSHF* | |||
Physicochemical properties | |||
| Number of amino acids: | 131 | ||
| Molecular weight: | 14,591.772 | ||
| Theoretical pI: | 11.380 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 60.226 | ||
| aromaticity | 0.115 | ||
| GRAVY | 0.208 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.305 | ||
| sheet | 0.214 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190794.1 | 3prime_partial | 217 | 53-703(+) |
Amino Acid sequence : | |||
| MEKVGKEGVITIQDGKTLFNELEVVEGMKLDRGYISPYFITNQKTQKCELDDPLILIHEKKISSINSIVKVLELALKRQRPLLIVAEDVESDALATLILNKLRAGIKVCAVKAPGFGENR KSNMQDLAVLTGGQVITEELGMNLDDVDLDMLGSCKKVTISKDDTVILDGAGEKKSIEERTDQITSAIELSTSDYDKEKLQERLAKLSRWCSCAKDW | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 14,591.772 | ||
| Theoretical pI: | 11.380 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 60.226 | ||
| aromaticity | 0.115 | ||
| GRAVY | 0.208 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.305 | ||
| sheet | 0.214 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190794.1 | complete | 131 | 582-187(-) |
Amino Acid sequence : | |||
| MDFFSPAPSRITVSSLEIVTFLHDPSISRSTSSKFIPSSSVMTWPPVKTARSCMFDFLFSPNPGAFTAQTLIPARSLLRIRVASASLSTSSATIRRGLCLFKANSRTLTMEFMLEIFFSW IRIRGSSNSHF* | |||
Physicochemical properties | |||
| Number of amino acids: | 131 | ||
| Molecular weight: | 14,591.772 | ||
| Theoretical pI: | 11.380 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 60.226 | ||
| aromaticity | 0.115 | ||
| GRAVY | 0.208 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.305 | ||
| sheet | 0.214 | ||