Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ190802.1 | internal | 287 | 861-1(-) |
Amino Acid sequence : | |||
DDDYADYELTGEAVTNEEIVEEAWQIVNDSFLDTGRHRWSADMWLKKKEDVLGASIQSRSRAHEIIRRMLASLGDPYTRFLSPTDFAKMARYDMTGIGINLREIPDENGTVRLKVLGLLL DGPAHSAGVRQGDELLSINGVDVKGKSAFEASSMLQGPSETFVNIMVKHGNCGPAQSVKVQRQSIAKSPVFYRLEQVKNGLNSVGYVRLKEFNALARKDLVTAMKRLQDMGASYFVLDLR DNLGGLVQAGIEIAKLFLNKGDIVTYTVGRDPLMVKNIVAESSPLFS | |||
Physicochemical properties | |||
Number of amino acids: | 287 | ||
Molecular weight: | 31,771.888 | ||
Theoretical pI: | 5.908 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28420 | ||
Instability index: | 40.023 | ||
aromaticity | 0.073 | ||
GRAVY | -0.229 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.233 | ||
sheet | 0.272 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ190802.1 | internal | 287 | 861-1(-) |
Amino Acid sequence : | |||
DDDYADYELTGEAVTNEEIVEEAWQIVNDSFLDTGRHRWSADMWLKKKEDVLGASIQSRSRAHEIIRRMLASLGDPYTRFLSPTDFAKMARYDMTGIGINLREIPDENGTVRLKVLGLLL DGPAHSAGVRQGDELLSINGVDVKGKSAFEASSMLQGPSETFVNIMVKHGNCGPAQSVKVQRQSIAKSPVFYRLEQVKNGLNSVGYVRLKEFNALARKDLVTAMKRLQDMGASYFVLDLR DNLGGLVQAGIEIAKLFLNKGDIVTYTVGRDPLMVKNIVAESSPLFS | |||
Physicochemical properties | |||
Number of amino acids: | 287 | ||
Molecular weight: | 31,771.888 | ||
Theoretical pI: | 5.908 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28420 | ||
Instability index: | 40.023 | ||
aromaticity | 0.073 | ||
GRAVY | -0.229 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.233 | ||
sheet | 0.272 |