| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190809.1 | 5prime_partial | 233 | 2-703(+) |
Amino Acid sequence : | |||
| PWYGIEQEYTLLQKNVKWPLGWPTGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGVNISGINGEVMPGQWEFQVGPAVGISAGDELWIARYILERITEIAGVVVSFDPKPIEGDW NGAGAHTNYSTKSMREEGGYEVIKKAIEKLGLKHKEHIAAYGEGNERRLTGKHETANINTFKWGVANRGASVRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILGGN* | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 25,584.481 | ||
| Theoretical pI: | 6.020 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 56380 56505 | ||
| Instability index: | 33.315 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.470 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.275 | ||
| sheet | 0.227 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190809.1 | 5prime_partial | 233 | 2-703(+) |
Amino Acid sequence : | |||
| PWYGIEQEYTLLQKNVKWPLGWPTGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGVNISGINGEVMPGQWEFQVGPAVGISAGDELWIARYILERITEIAGVVVSFDPKPIEGDW NGAGAHTNYSTKSMREEGGYEVIKKAIEKLGLKHKEHIAAYGEGNERRLTGKHETANINTFKWGVANRGASVRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILGGN* | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 25,584.481 | ||
| Theoretical pI: | 6.020 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 56380 56505 | ||
| Instability index: | 33.315 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.470 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.275 | ||
| sheet | 0.227 | ||