Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ190809.1 | 5prime_partial | 233 | 2-703(+) |
Amino Acid sequence : | |||
PWYGIEQEYTLLQKNVKWPLGWPTGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGVNISGINGEVMPGQWEFQVGPAVGISAGDELWIARYILERITEIAGVVVSFDPKPIEGDW NGAGAHTNYSTKSMREEGGYEVIKKAIEKLGLKHKEHIAAYGEGNERRLTGKHETANINTFKWGVANRGASVRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILGGN* | |||
Physicochemical properties | |||
Number of amino acids: | 233 | ||
Molecular weight: | 25,584.481 | ||
Theoretical pI: | 6.020 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 56380 56505 | ||
Instability index: | 33.315 | ||
aromaticity | 0.107 | ||
GRAVY | -0.470 | ||
Secondary Structure Fraction | |||
Helix | 0.288 | ||
turn | 0.275 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ190809.1 | 5prime_partial | 233 | 2-703(+) |
Amino Acid sequence : | |||
PWYGIEQEYTLLQKNVKWPLGWPTGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGVNISGINGEVMPGQWEFQVGPAVGISAGDELWIARYILERITEIAGVVVSFDPKPIEGDW NGAGAHTNYSTKSMREEGGYEVIKKAIEKLGLKHKEHIAAYGEGNERRLTGKHETANINTFKWGVANRGASVRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILGGN* | |||
Physicochemical properties | |||
Number of amino acids: | 233 | ||
Molecular weight: | 25,584.481 | ||
Theoretical pI: | 6.020 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 56380 56505 | ||
Instability index: | 33.315 | ||
aromaticity | 0.107 | ||
GRAVY | -0.470 | ||
Secondary Structure Fraction | |||
Helix | 0.288 | ||
turn | 0.275 | ||
sheet | 0.227 |