| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190824.1 | internal | 154 | 2-463(+) |
Amino Acid sequence : | |||
| LKDGLAAVHVPYSYGFAIILLTVLVKVATLPLTKQQVESTLAMQNLQPKIKAIQQRYAGNQERIQLETSRLYKQAGVNPLAGCLPTLATIPVWIGLYQALSNVANEGLLTEGFFWIPSLG GPTTIAAQQSGSGISWLFPFVDGHPPLGWHDTAA | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 16,609.022 | ||
| Theoretical pI: | 8.075 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29450 | ||
| Instability index: | 37.262 | ||
| aromaticity | 0.091 | ||
| GRAVY | 0.212 | ||
Secondary Structure Fraction | |||
| Helix | 0.357 | ||
| turn | 0.247 | ||
| sheet | 0.279 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190824.1 | internal | 154 | 2-463(+) |
Amino Acid sequence : | |||
| LKDGLAAVHVPYSYGFAIILLTVLVKVATLPLTKQQVESTLAMQNLQPKIKAIQQRYAGNQERIQLETSRLYKQAGVNPLAGCLPTLATIPVWIGLYQALSNVANEGLLTEGFFWIPSLG GPTTIAAQQSGSGISWLFPFVDGHPPLGWHDTAA | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 16,609.022 | ||
| Theoretical pI: | 8.075 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29450 | ||
| Instability index: | 37.262 | ||
| aromaticity | 0.091 | ||
| GRAVY | 0.212 | ||
Secondary Structure Fraction | |||
| Helix | 0.357 | ||
| turn | 0.247 | ||
| sheet | 0.279 | ||