Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ190824.1 | internal | 154 | 2-463(+) |
Amino Acid sequence : | |||
LKDGLAAVHVPYSYGFAIILLTVLVKVATLPLTKQQVESTLAMQNLQPKIKAIQQRYAGNQERIQLETSRLYKQAGVNPLAGCLPTLATIPVWIGLYQALSNVANEGLLTEGFFWIPSLG GPTTIAAQQSGSGISWLFPFVDGHPPLGWHDTAA | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 16,609.022 | ||
Theoretical pI: | 8.075 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29450 | ||
Instability index: | 37.262 | ||
aromaticity | 0.091 | ||
GRAVY | 0.212 | ||
Secondary Structure Fraction | |||
Helix | 0.357 | ||
turn | 0.247 | ||
sheet | 0.279 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ190824.1 | internal | 154 | 2-463(+) |
Amino Acid sequence : | |||
LKDGLAAVHVPYSYGFAIILLTVLVKVATLPLTKQQVESTLAMQNLQPKIKAIQQRYAGNQERIQLETSRLYKQAGVNPLAGCLPTLATIPVWIGLYQALSNVANEGLLTEGFFWIPSLG GPTTIAAQQSGSGISWLFPFVDGHPPLGWHDTAA | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 16,609.022 | ||
Theoretical pI: | 8.075 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29450 | ||
Instability index: | 37.262 | ||
aromaticity | 0.091 | ||
GRAVY | 0.212 | ||
Secondary Structure Fraction | |||
Helix | 0.357 | ||
turn | 0.247 | ||
sheet | 0.279 |