| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190836.1 | internal | 211 | 1-633(+) |
Amino Acid sequence : | |||
| RYKDEDDREKLSKLTELEREMILEARATKRSDRDLTEKLKKRKGLDRKGSPPKVPTRSMRSKAERAGALDELVKRRRESAKGGSGSRYSPVKRRSFTAATLSSPSRSESGSHSDGGDSTG DGGLADSDDEKISAESKVPTFEDIKEITIRRSKLAKWFMEPFFDELIVGCFVRVGIGKSRSGSVYRLCVVRNVDSTDPDRQYKLDNKTTHK | |||
Physicochemical properties | |||
| Number of amino acids: | 211 | ||
| Molecular weight: | 23,733.416 | ||
| Theoretical pI: | 9.714 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 62.222 | ||
| aromaticity | 0.052 | ||
| GRAVY | -1.031 | ||
Secondary Structure Fraction | |||
| Helix | 0.209 | ||
| turn | 0.246 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190836.1 | internal | 211 | 1-633(+) |
Amino Acid sequence : | |||
| RYKDEDDREKLSKLTELEREMILEARATKRSDRDLTEKLKKRKGLDRKGSPPKVPTRSMRSKAERAGALDELVKRRRESAKGGSGSRYSPVKRRSFTAATLSSPSRSESGSHSDGGDSTG DGGLADSDDEKISAESKVPTFEDIKEITIRRSKLAKWFMEPFFDELIVGCFVRVGIGKSRSGSVYRLCVVRNVDSTDPDRQYKLDNKTTHK | |||
Physicochemical properties | |||
| Number of amino acids: | 211 | ||
| Molecular weight: | 23,733.416 | ||
| Theoretical pI: | 9.714 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 62.222 | ||
| aromaticity | 0.052 | ||
| GRAVY | -1.031 | ||
Secondary Structure Fraction | |||
| Helix | 0.209 | ||
| turn | 0.246 | ||
| sheet | 0.218 | ||