| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190837.1 | 5prime_partial | 166 | 2-502(+) |
Amino Acid sequence : | |||
| QRSLEGFPGITPFDGMASGVAALARHLPAGSPSIFYCISSPIQKATSLCKSVDDLDNDLWKNWEGELDPPKKVLDLLLRLLSLVDIQVLPELMKSLAQLIVQLPMNGQNVLLNQLYQQIA ESDDVIRKPALVSWVQSLSYLCSQDSARKRTASANSVSLNGLSARL* | |||
Physicochemical properties | |||
| Number of amino acids: | 166 | ||
| Molecular weight: | 18,146.739 | ||
| Theoretical pI: | 5.794 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
| Instability index: | 39.577 | ||
| aromaticity | 0.054 | ||
| GRAVY | 0.029 | ||
Secondary Structure Fraction | |||
| Helix | 0.337 | ||
| turn | 0.271 | ||
| sheet | 0.295 | ||