Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ190842.1 | complete | 143 | 66-497(+) |
Amino Acid sequence : | |||
MVTVPGQLIWEIVKKNNSFLVKEFGNGTAGVKFSKEPNNLYNIHSFKHSGLANKKTVTIQPGKDQTVVLATTKTKRQNKPAALLSKSVMKKEFHRMAKAVSNQVSDNYYRPDLKKAALAR LSVVHRSLKVAKSGAKKRNRQAS* | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 15,918.376 | ||
Theoretical pI: | 10.680 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 26.238 | ||
aromaticity | 0.063 | ||
GRAVY | -0.582 | ||
Secondary Structure Fraction | |||
Helix | 0.266 | ||
turn | 0.245 | ||
sheet | 0.217 |