| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190850.1 | internal | 263 | 2-790(+) |
Amino Acid sequence : | |||
| PNEERYAFALFADEMCSSYEEPDHLQMPETIAALMGPLNGVFCVVNITGSMALLNPAMKQFKPLPPLRPNVQPHLSSYDNLLGFGLDVSTGDYKLVSLQYFWNEETDAPHDPSLVSVYSS STDSWRHFEDPNLVNSSHCAYRSLCNTYLNGFYCWLMEFNDTDVSILAFDMANEKFREIKVPDCIKSKEGDLTVYGDSLALLSCDLDKIDKCVDIWVMEEEGCWVKSSTVGPFVDIRWPL GFWKKNELLLETGTPFLTLYNVC | |||
Physicochemical properties | |||
| Number of amino acids: | 263 | ||
| Molecular weight: | 12,213.371 | ||
| Theoretical pI: | 9.977 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 55.671 | ||
| aromaticity | 0.082 | ||
| GRAVY | -0.535 | ||
Secondary Structure Fraction | |||
| Helix | 0.245 | ||
| turn | 0.391 | ||
| sheet | 0.155 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190850.1 | 5prime_partial | 110 | 789-457(-) |
Amino Acid sequence : | |||
| HTLYRVRNGVPVSNNSSFFFQNPNGQRISTNGPTVELFTQQPSSSITHMSTHLSILSKSHDNKANESPYTVRSPSFDFIQSGTLISRNFSLAMSNARMETSVSLNSMSQQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 12,213.371 | ||
| Theoretical pI: | 9.977 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 55.671 | ||
| aromaticity | 0.082 | ||
| GRAVY | -0.535 | ||
Secondary Structure Fraction | |||
| Helix | 0.245 | ||
| turn | 0.391 | ||
| sheet | 0.155 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190850.1 | internal | 263 | 2-790(+) |
Amino Acid sequence : | |||
| PNEERYAFALFADEMCSSYEEPDHLQMPETIAALMGPLNGVFCVVNITGSMALLNPAMKQFKPLPPLRPNVQPHLSSYDNLLGFGLDVSTGDYKLVSLQYFWNEETDAPHDPSLVSVYSS STDSWRHFEDPNLVNSSHCAYRSLCNTYLNGFYCWLMEFNDTDVSILAFDMANEKFREIKVPDCIKSKEGDLTVYGDSLALLSCDLDKIDKCVDIWVMEEEGCWVKSSTVGPFVDIRWPL GFWKKNELLLETGTPFLTLYNVC | |||
Physicochemical properties | |||
| Number of amino acids: | 263 | ||
| Molecular weight: | 12,213.371 | ||
| Theoretical pI: | 9.977 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 55.671 | ||
| aromaticity | 0.082 | ||
| GRAVY | -0.535 | ||
Secondary Structure Fraction | |||
| Helix | 0.245 | ||
| turn | 0.391 | ||
| sheet | 0.155 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190850.1 | 5prime_partial | 110 | 789-457(-) |
Amino Acid sequence : | |||
| HTLYRVRNGVPVSNNSSFFFQNPNGQRISTNGPTVELFTQQPSSSITHMSTHLSILSKSHDNKANESPYTVRSPSFDFIQSGTLISRNFSLAMSNARMETSVSLNSMSQQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 12,213.371 | ||
| Theoretical pI: | 9.977 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 55.671 | ||
| aromaticity | 0.082 | ||
| GRAVY | -0.535 | ||
Secondary Structure Fraction | |||
| Helix | 0.245 | ||
| turn | 0.391 | ||
| sheet | 0.155 | ||