| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190857.1 | 3prime_partial | 267 | 802-2(-) |
Amino Acid sequence : | |||
| MSTARIALLKISSSLLWTVCVASGYNLLRDPHHNKGLAFTEKERDAHYLRGLLPPVVISQELQEKKLMHNIRQYQLPLHKYMAMMELEERNERLFYKLLIDNVEELLPVVYTPTVGEACQ KYGSIFRRPQGVYISLKDKGKILEVLRNWPERAIQVIVVTDGERILGLGDLGCQGMGIPVGKLALYTALGGVRPSACLPITIDVGTNNEQLLNDEFYIGLRQKRATGKEYYDLLEEFMTA VKQNYGEKVLIQFEDFVNHNAFELLAK | |||
Physicochemical properties | |||
| Number of amino acids: | 267 | ||
| Molecular weight: | 30,428.034 | ||
| Theoretical pI: | 7.013 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30620 | ||
| Instability index: | 49.093 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.147 | ||
Secondary Structure Fraction | |||
| Helix | 0.360 | ||
| turn | 0.195 | ||
| sheet | 0.307 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190857.1 | 3prime_partial | 267 | 802-2(-) |
Amino Acid sequence : | |||
| MSTARIALLKISSSLLWTVCVASGYNLLRDPHHNKGLAFTEKERDAHYLRGLLPPVVISQELQEKKLMHNIRQYQLPLHKYMAMMELEERNERLFYKLLIDNVEELLPVVYTPTVGEACQ KYGSIFRRPQGVYISLKDKGKILEVLRNWPERAIQVIVVTDGERILGLGDLGCQGMGIPVGKLALYTALGGVRPSACLPITIDVGTNNEQLLNDEFYIGLRQKRATGKEYYDLLEEFMTA VKQNYGEKVLIQFEDFVNHNAFELLAK | |||
Physicochemical properties | |||
| Number of amino acids: | 267 | ||
| Molecular weight: | 30,428.034 | ||
| Theoretical pI: | 7.013 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30620 | ||
| Instability index: | 49.093 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.147 | ||
Secondary Structure Fraction | |||
| Helix | 0.360 | ||
| turn | 0.195 | ||
| sheet | 0.307 | ||