| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190858.1 | internal | 129 | 3-389(+) |
Amino Acid sequence : | |||
| FAASAKMEQTFVMIKPDGVQRNLVGEIIGRFEKKGFTLKGLKLITVDRAFAESHYADLSAKPFFNGLVEYIISGPVVAMVWEGKNVVATGRKIIGATNPAESAPGAIRGDYAIDIGRNVI HGSDAVESA | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 13,795.711 | ||
| Theoretical pI: | 8.190 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 20.132 | ||
| aromaticity | 0.085 | ||
| GRAVY | 0.091 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.240 | ||
| sheet | 0.256 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190858.1 | internal | 129 | 3-389(+) |
Amino Acid sequence : | |||
| FAASAKMEQTFVMIKPDGVQRNLVGEIIGRFEKKGFTLKGLKLITVDRAFAESHYADLSAKPFFNGLVEYIISGPVVAMVWEGKNVVATGRKIIGATNPAESAPGAIRGDYAIDIGRNVI HGSDAVESA | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 13,795.711 | ||
| Theoretical pI: | 8.190 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 20.132 | ||
| aromaticity | 0.085 | ||
| GRAVY | 0.091 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.240 | ||
| sheet | 0.256 | ||