Acc_NO	ORF type	length	start-end position (strand +/-)
>JZ190888.1	3prime_partial	166	499-2(-)
Amino Acid sequence :
MEEGLLVKERLWKRGAGWRDIWEEMKRLGYIAGPMVAVTLSFFLLSAVSLMLVGHLGELALSSTAIAISFAGVTGFSLLLGMASGLETISGQAFGAEQCEKLGTHTYTAIVSLTIVCIPL SVLWIYMGDILEFAGQDPEISHEAGRFSIWLIPTLFGYAFLQPLIR
Physicochemical properties
Number of amino acids:		166
Molecular weight:		18,114.085
Theoretical pI:		5.120
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		33460 33585
Instability index:		27.427
aromaticity		0.108
GRAVY		0.627
Secondary Structure Fraction
Helix		0.398
turn		0.217
sheet		0.349

Acc_NO	ORF type	length	start-end position (strand +/-)
>JZ190888.1	3prime_partial	166	499-2(-)
Amino Acid sequence :
MEEGLLVKERLWKRGAGWRDIWEEMKRLGYIAGPMVAVTLSFFLLSAVSLMLVGHLGELALSSTAIAISFAGVTGFSLLLGMASGLETISGQAFGAEQCEKLGTHTYTAIVSLTIVCIPL SVLWIYMGDILEFAGQDPEISHEAGRFSIWLIPTLFGYAFLQPLIR
Physicochemical properties
Number of amino acids:		166
Molecular weight:		18,114.085
Theoretical pI:		5.120
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		33460 33585
Instability index:		27.427
aromaticity		0.108
GRAVY		0.627
Secondary Structure Fraction
Helix		0.398
turn		0.217
sheet		0.349