| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190893.1 | internal | 278 | 835-2(-) |
Amino Acid sequence : | |||
| KLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNFSFEEVNHHMAENLAVIAKEHGGIVRYIQVSCLGASSSSPSKMLRAKAAAEEAVLRELPEGTVMRPAAIVGTEDRV LNPWAFFAKKYGFIPLMGDGSTKIQPVYVVDVASAIVAALKDDGSSMGKIYELGGPEIYTIRELADLMFDTIREWPHYIKVPFPVVKAISMPRELLLKKVPFPMPVPSIFNLDQIEALST DTLVSEDALTFKDLGIAPQKLKGYPVEFLIQFRKGGPQ | |||
Physicochemical properties | |||
| Number of amino acids: | 278 | ||
| Molecular weight: | 30,737.488 | ||
| Theoretical pI: | 6.521 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24410 | ||
| Instability index: | 33.913 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.000 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.230 | ||
| sheet | 0.288 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190893.1 | internal | 278 | 835-2(-) |
Amino Acid sequence : | |||
| KLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNFSFEEVNHHMAENLAVIAKEHGGIVRYIQVSCLGASSSSPSKMLRAKAAAEEAVLRELPEGTVMRPAAIVGTEDRV LNPWAFFAKKYGFIPLMGDGSTKIQPVYVVDVASAIVAALKDDGSSMGKIYELGGPEIYTIRELADLMFDTIREWPHYIKVPFPVVKAISMPRELLLKKVPFPMPVPSIFNLDQIEALST DTLVSEDALTFKDLGIAPQKLKGYPVEFLIQFRKGGPQ | |||
Physicochemical properties | |||
| Number of amino acids: | 278 | ||
| Molecular weight: | 30,737.488 | ||
| Theoretical pI: | 6.521 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24410 | ||
| Instability index: | 33.913 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.000 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.230 | ||
| sheet | 0.288 | ||