| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190894.1 | internal | 196 | 3-590(+) |
Amino Acid sequence : | |||
| STRENNVAKIKVVVRKRPLNKKETARKEEDIVDVYDEACLTVHEPKLKVDLTAYVEKHEFCFDAVLDEQVTNDEVYRKTVEPIIPIIFQRTKATCFAYGQTGSGKTYTMQPLPLRAAEDL VRLLHQPVYRNQRFKLWLSYFEIYGGKLFDLLSERKKLCMREDGRQQVCIVGLQEFEVSDVAIVKEYIERGNAARS | |||
Physicochemical properties | |||
| Number of amino acids: | 196 | ||
| Molecular weight: | 22,779.953 | ||
| Theoretical pI: | 8.192 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19160 | ||
| Instability index: | 30.094 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.441 | ||
Secondary Structure Fraction | |||
| Helix | 0.332 | ||
| turn | 0.138 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190894.1 | internal | 196 | 3-590(+) |
Amino Acid sequence : | |||
| STRENNVAKIKVVVRKRPLNKKETARKEEDIVDVYDEACLTVHEPKLKVDLTAYVEKHEFCFDAVLDEQVTNDEVYRKTVEPIIPIIFQRTKATCFAYGQTGSGKTYTMQPLPLRAAEDL VRLLHQPVYRNQRFKLWLSYFEIYGGKLFDLLSERKKLCMREDGRQQVCIVGLQEFEVSDVAIVKEYIERGNAARS | |||
Physicochemical properties | |||
| Number of amino acids: | 196 | ||
| Molecular weight: | 22,779.953 | ||
| Theoretical pI: | 8.192 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19160 | ||
| Instability index: | 30.094 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.441 | ||
Secondary Structure Fraction | |||
| Helix | 0.332 | ||
| turn | 0.138 | ||
| sheet | 0.255 | ||