| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190902.1 | 3prime_partial | 109 | 329-3(-) |
Amino Acid sequence : | |||
| MNEKDPSILHFLLASGDDVSSKQLRDDLMTMLIAGHETSAAVLTWTFYLLSQYPSVVAKLQNEVDSVLGDRFPTVEDMKKLKYTTRVINESLRLYPQPPVLIRRSLGDD | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 12,355.036 | ||
| Theoretical pI: | 5.282 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 47.395 | ||
| aromaticity | 0.073 | ||
| GRAVY | -0.206 | ||
Secondary Structure Fraction | |||
| Helix | 0.339 | ||
| turn | 0.211 | ||
| sheet | 0.275 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190902.1 | 3prime_partial | 109 | 329-3(-) |
Amino Acid sequence : | |||
| MNEKDPSILHFLLASGDDVSSKQLRDDLMTMLIAGHETSAAVLTWTFYLLSQYPSVVAKLQNEVDSVLGDRFPTVEDMKKLKYTTRVINESLRLYPQPPVLIRRSLGDD | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 12,355.036 | ||
| Theoretical pI: | 5.282 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 47.395 | ||
| aromaticity | 0.073 | ||
| GRAVY | -0.206 | ||
Secondary Structure Fraction | |||
| Helix | 0.339 | ||
| turn | 0.211 | ||
| sheet | 0.275 | ||