| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190907.1 | 5prime_partial | 114 | 368-24(-) |
Amino Acid sequence : | |||
| LNDCQRTDFYEGIGLNTKEFDMHVIIETNRTTARIFPAVLDVENPEFKRKLDRMVEINTQILAIGDTDDIPLVKNLKRIPLIAALASELLAAYLMKPIESGSVDFAEFEPQLVY* | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 12,955.782 | ||
| Theoretical pI: | 4.618 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 32.048 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.039 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.167 | ||
| sheet | 0.307 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190907.1 | 5prime_partial | 114 | 368-24(-) |
Amino Acid sequence : | |||
| LNDCQRTDFYEGIGLNTKEFDMHVIIETNRTTARIFPAVLDVENPEFKRKLDRMVEINTQILAIGDTDDIPLVKNLKRIPLIAALASELLAAYLMKPIESGSVDFAEFEPQLVY* | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 12,955.782 | ||
| Theoretical pI: | 4.618 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 32.048 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.039 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.167 | ||
| sheet | 0.307 | ||