| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190915.1 | internal | 172 | 516-1(-) |
Amino Acid sequence : | |||
| LTTFTGLYRYRLGDVVEVAGFHRNTPKLNFICRRKLILTVNIDKNTERDLQSVVERGSQILRNTRGDLVDFTSHADIAKQPGHYIIYWEVEGEVEEGVLGECCREMDASFVDQGYVVSRK SNSIGPLELCIVERGTFKKIMEYFIANGAALSQFKTPRRTSNPVLLRILNLC | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 12,016.869 | ||
| Theoretical pI: | 10.269 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 64.722 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.284 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.212 | ||
| sheet | 0.279 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190915.1 | 5prime_partial | 104 | 1-315(+) |
Amino Acid sequence : | |||
| TQIQNPQQNRIASASRSLELAQSCPICNEILHDLLKRAPLHNAQLQRSDRVALPRYDVALIHERRVHFPATLSKNPLLHLPFHLPINYVMPRLLSYVRVARKID* | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 12,016.869 | ||
| Theoretical pI: | 10.269 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 64.722 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.284 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.212 | ||
| sheet | 0.279 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190915.1 | internal | 172 | 516-1(-) |
Amino Acid sequence : | |||
| LTTFTGLYRYRLGDVVEVAGFHRNTPKLNFICRRKLILTVNIDKNTERDLQSVVERGSQILRNTRGDLVDFTSHADIAKQPGHYIIYWEVEGEVEEGVLGECCREMDASFVDQGYVVSRK SNSIGPLELCIVERGTFKKIMEYFIANGAALSQFKTPRRTSNPVLLRILNLC | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 12,016.869 | ||
| Theoretical pI: | 10.269 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 64.722 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.284 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.212 | ||
| sheet | 0.279 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190915.1 | 5prime_partial | 104 | 1-315(+) |
Amino Acid sequence : | |||
| TQIQNPQQNRIASASRSLELAQSCPICNEILHDLLKRAPLHNAQLQRSDRVALPRYDVALIHERRVHFPATLSKNPLLHLPFHLPINYVMPRLLSYVRVARKID* | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 12,016.869 | ||
| Theoretical pI: | 10.269 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 64.722 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.284 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.212 | ||
| sheet | 0.279 | ||