| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190918.1 | internal | 172 | 516-1(-) |
Amino Acid sequence : | |||
| LTTFTGLYRYRLGDVVEVAGFHRNTPKLNFICRRKLILTVNIDKNTERDLQSVVERGSQILRNTRGDLVDFTSHADIAKRPGHYIIYWEVEGDVEERVLGECCREMDASFVDQGYVVSRK SNSIGPLELCIVERGTFKKIMEYFIANGAALSQFKTPRCTSNPVLLRILNLC | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 12,004.876 | ||
| Theoretical pI: | 9.756 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6210 | ||
| Instability index: | 63.661 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.196 | ||
Secondary Structure Fraction | |||
| Helix | 0.337 | ||
| turn | 0.221 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190918.1 | 5prime_partial | 104 | 1-315(+) |
Amino Acid sequence : | |||
| TQIQNPQQNRIASASRSLELAQSCPICNEILHDLLKRAPLHNAQLQRPDRVALPRYDIALIHERCVHFPATFSKNPLLHIPFYLPINYVVPRSLCYVRVARKIN* | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 12,004.876 | ||
| Theoretical pI: | 9.756 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6210 | ||
| Instability index: | 63.661 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.196 | ||
Secondary Structure Fraction | |||
| Helix | 0.337 | ||
| turn | 0.221 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190918.1 | internal | 172 | 516-1(-) |
Amino Acid sequence : | |||
| LTTFTGLYRYRLGDVVEVAGFHRNTPKLNFICRRKLILTVNIDKNTERDLQSVVERGSQILRNTRGDLVDFTSHADIAKRPGHYIIYWEVEGDVEERVLGECCREMDASFVDQGYVVSRK SNSIGPLELCIVERGTFKKIMEYFIANGAALSQFKTPRCTSNPVLLRILNLC | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 12,004.876 | ||
| Theoretical pI: | 9.756 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6210 | ||
| Instability index: | 63.661 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.196 | ||
Secondary Structure Fraction | |||
| Helix | 0.337 | ||
| turn | 0.221 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190918.1 | 5prime_partial | 104 | 1-315(+) |
Amino Acid sequence : | |||
| TQIQNPQQNRIASASRSLELAQSCPICNEILHDLLKRAPLHNAQLQRPDRVALPRYDIALIHERCVHFPATFSKNPLLHIPFYLPINYVVPRSLCYVRVARKIN* | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 12,004.876 | ||
| Theoretical pI: | 9.756 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6210 | ||
| Instability index: | 63.661 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.196 | ||
Secondary Structure Fraction | |||
| Helix | 0.337 | ||
| turn | 0.221 | ||
| sheet | 0.240 | ||