| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190920.1 | complete | 118 | 369-13(-) |
Amino Acid sequence : | |||
| MELVVWISLGHHDLDELLVVDLPITIHISLTDHLVNLFIGKLLSKVCHDMTKLSCRNKSILVLVEDTESFLQFLLRISIFHLSGHQVEELWEIDCPIAISVNFIDHILKFSLCGVLPQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 13,096.433 | ||
| Theoretical pI: | 4.187 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 28.517 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.643 | ||
Secondary Structure Fraction | |||
| Helix | 0.243 | ||
| turn | 0.165 | ||
| sheet | 0.348 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190920.1 | 5prime_partial | 115 | 1-348(+) |
Amino Acid sequence : | |||
| TVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 13,096.433 | ||
| Theoretical pI: | 4.187 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 28.517 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.643 | ||
Secondary Structure Fraction | |||
| Helix | 0.243 | ||
| turn | 0.165 | ||
| sheet | 0.348 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190920.1 | complete | 118 | 369-13(-) |
Amino Acid sequence : | |||
| MELVVWISLGHHDLDELLVVDLPITIHISLTDHLVNLFIGKLLSKVCHDMTKLSCRNKSILVLVEDTESFLQFLLRISIFHLSGHQVEELWEIDCPIAISVNFIDHILKFSLCGVLPQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 13,096.433 | ||
| Theoretical pI: | 4.187 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 28.517 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.643 | ||
Secondary Structure Fraction | |||
| Helix | 0.243 | ||
| turn | 0.165 | ||
| sheet | 0.348 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190920.1 | 5prime_partial | 115 | 1-348(+) |
Amino Acid sequence : | |||
| TVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 13,096.433 | ||
| Theoretical pI: | 4.187 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 28.517 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.643 | ||
Secondary Structure Fraction | |||
| Helix | 0.243 | ||
| turn | 0.165 | ||
| sheet | 0.348 | ||