Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ190923.1 | internal | 177 | 2-532(+) |
Amino Acid sequence : | |||
AHDNNHEVRSAALSGGLSPFKCNRYINKSLRDPTVKFLMENLEKSGCRVASNFIQAATCETLCSGGYTSGSGIVVCCNHLDVQEQVRRTIVHELVHAYDECRAANLDWDNCAHHACSEIR ASHLSGDCRYKLELLRGFTKLRGHEPECVRRRALESMRGKSCCSETAAEDAVDAVWS | |||
Physicochemical properties | |||
Number of amino acids: | 177 | ||
Molecular weight: | 19,644.934 | ||
Theoretical pI: | 6.811 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17710 | ||
Instability index: | 40.777 | ||
aromaticity | 0.056 | ||
GRAVY | -0.407 | ||
Secondary Structure Fraction | |||
Helix | 0.237 | ||
turn | 0.220 | ||
sheet | 0.271 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ190923.1 | internal | 177 | 2-532(+) |
Amino Acid sequence : | |||
AHDNNHEVRSAALSGGLSPFKCNRYINKSLRDPTVKFLMENLEKSGCRVASNFIQAATCETLCSGGYTSGSGIVVCCNHLDVQEQVRRTIVHELVHAYDECRAANLDWDNCAHHACSEIR ASHLSGDCRYKLELLRGFTKLRGHEPECVRRRALESMRGKSCCSETAAEDAVDAVWS | |||
Physicochemical properties | |||
Number of amino acids: | 177 | ||
Molecular weight: | 19,644.934 | ||
Theoretical pI: | 6.811 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17710 | ||
Instability index: | 40.777 | ||
aromaticity | 0.056 | ||
GRAVY | -0.407 | ||
Secondary Structure Fraction | |||
Helix | 0.237 | ||
turn | 0.220 | ||
sheet | 0.271 |