| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190925.1 | internal | 212 | 2-637(+) |
Amino Acid sequence : | |||
| LCPKDPEKLKESLATGLDSWDWNLDGKNSTYHALFPRAWTVYDGEPDPALKIVCRQLSPFIPHNYKDSNLPVAVFTYTLSNLGKTEADVTLLFSWANSVGGDSGLSGHHFNSKFRAEDNV SGVLLHHMTGNDRPSLTFAIAAEATNVVHVSECPCFVISGNSQGITARDMWSEIKERGSFDHLNSEEMSTPSEPGSVIGAAVAASLTIPPET | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 23,005.397 | ||
| Theoretical pI: | 5.047 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33710 | ||
| Instability index: | 35.347 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.262 | ||
Secondary Structure Fraction | |||
| Helix | 0.278 | ||
| turn | 0.302 | ||
| sheet | 0.245 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190925.1 | internal | 212 | 2-637(+) |
Amino Acid sequence : | |||
| LCPKDPEKLKESLATGLDSWDWNLDGKNSTYHALFPRAWTVYDGEPDPALKIVCRQLSPFIPHNYKDSNLPVAVFTYTLSNLGKTEADVTLLFSWANSVGGDSGLSGHHFNSKFRAEDNV SGVLLHHMTGNDRPSLTFAIAAEATNVVHVSECPCFVISGNSQGITARDMWSEIKERGSFDHLNSEEMSTPSEPGSVIGAAVAASLTIPPET | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 23,005.397 | ||
| Theoretical pI: | 5.047 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33710 | ||
| Instability index: | 35.347 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.262 | ||
Secondary Structure Fraction | |||
| Helix | 0.278 | ||
| turn | 0.302 | ||
| sheet | 0.245 | ||