| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190926.1 | 5prime_partial | 237 | 2-715(+) |
Amino Acid sequence : | |||
| RRYARGLKKLIKIGQGPEMLVRKASGLGGDSVDTYFDADGGDAVEAHEWRCVRAVNGVRIFEDVASLKSGKGILVKAVGVVDASADTVFEIMLNLDRRRRYEWDTLTGDLELVDSINGHF DIVCGTFDPRYVTWWQSKKDFVFSRQWFRGQDGTYTILQLPPVDKKRPPRSGYKHTKINSSTWEISNLGTSSSLNSARCLVTQTPEINPKGWFKWRNKHWPKLEKSVPYALLSQVSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 26,867.265 | ||
| Theoretical pI: | 9.472 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 59930 60055 | ||
| Instability index: | 29.422 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.458 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.241 | ||
| sheet | 0.181 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190926.1 | 5prime_partial | 237 | 2-715(+) |
Amino Acid sequence : | |||
| RRYARGLKKLIKIGQGPEMLVRKASGLGGDSVDTYFDADGGDAVEAHEWRCVRAVNGVRIFEDVASLKSGKGILVKAVGVVDASADTVFEIMLNLDRRRRYEWDTLTGDLELVDSINGHF DIVCGTFDPRYVTWWQSKKDFVFSRQWFRGQDGTYTILQLPPVDKKRPPRSGYKHTKINSSTWEISNLGTSSSLNSARCLVTQTPEINPKGWFKWRNKHWPKLEKSVPYALLSQVSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 26,867.265 | ||
| Theoretical pI: | 9.472 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 59930 60055 | ||
| Instability index: | 29.422 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.458 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.241 | ||
| sheet | 0.181 | ||