Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ190929.1 | 5prime_partial | 265 | 3-800(+) |
Amino Acid sequence : | |||
THHGLQVSFTGNYNEYFGFATDVDAVVYLMLVNDMIHGLFPEAVAIGEDVSGMPTFCIPLQDGGVGFDYRLQMAIADKWIETLKKRDEDWKMGDIIHTLTNRRWLEKCVAYAESHDQALV GDKTIALWLMDKDMYDFMALDGPSTPVIDRGIALHKMIRLVTMGLGGEGYLNFMGNEFGHPEWIDFPREGNGFSYEKCRRRFDLGDADYLRYGGMQEFDRAMQHLEEKYNFMTSERQFIS KKDESDRIIVFERGDLVFVFNFHWK* | |||
Physicochemical properties | |||
Number of amino acids: | 265 | ||
Molecular weight: | 12,541.371 | ||
Theoretical pI: | 8.342 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 58.948 | ||
aromaticity | 0.121 | ||
GRAVY | -0.058 | ||
Secondary Structure Fraction | |||
Helix | 0.355 | ||
turn | 0.243 | ||
sheet | 0.121 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ190929.1 | complete | 107 | 347-24(-) |
Amino Acid sequence : | |||
MTFCISDAFFQPPTVCECVNDVSHFPIFVPFLEGFYPLISNSHLQTIVKSNTTILKRNTKRWHSTYIFTNRYSFREEPMNHIINQHQIHHSINICCESKILIVVPSK* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 12,541.371 | ||
Theoretical pI: | 8.342 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 58.948 | ||
aromaticity | 0.121 | ||
GRAVY | -0.058 | ||
Secondary Structure Fraction | |||
Helix | 0.355 | ||
turn | 0.243 | ||
sheet | 0.121 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ190929.1 | 5prime_partial | 265 | 3-800(+) |
Amino Acid sequence : | |||
THHGLQVSFTGNYNEYFGFATDVDAVVYLMLVNDMIHGLFPEAVAIGEDVSGMPTFCIPLQDGGVGFDYRLQMAIADKWIETLKKRDEDWKMGDIIHTLTNRRWLEKCVAYAESHDQALV GDKTIALWLMDKDMYDFMALDGPSTPVIDRGIALHKMIRLVTMGLGGEGYLNFMGNEFGHPEWIDFPREGNGFSYEKCRRRFDLGDADYLRYGGMQEFDRAMQHLEEKYNFMTSERQFIS KKDESDRIIVFERGDLVFVFNFHWK* | |||
Physicochemical properties | |||
Number of amino acids: | 265 | ||
Molecular weight: | 12,541.371 | ||
Theoretical pI: | 8.342 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 58.948 | ||
aromaticity | 0.121 | ||
GRAVY | -0.058 | ||
Secondary Structure Fraction | |||
Helix | 0.355 | ||
turn | 0.243 | ||
sheet | 0.121 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ190929.1 | complete | 107 | 347-24(-) |
Amino Acid sequence : | |||
MTFCISDAFFQPPTVCECVNDVSHFPIFVPFLEGFYPLISNSHLQTIVKSNTTILKRNTKRWHSTYIFTNRYSFREEPMNHIINQHQIHHSINICCESKILIVVPSK* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 12,541.371 | ||
Theoretical pI: | 8.342 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 58.948 | ||
aromaticity | 0.121 | ||
GRAVY | -0.058 | ||
Secondary Structure Fraction | |||
Helix | 0.355 | ||
turn | 0.243 | ||
sheet | 0.121 |