Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ190930.1 | internal | 210 | 1-630(+) |
Amino Acid sequence : | |||
YKDEDDREKLSKLTELEREMILEARATKRSDRDLTEKLKKRKGLDRKGSPPKVPTRSMRSKAERAGALDELVKRRRESAKGGSGSRYSPVKRRSFTAATLSSPSRSESGSHSDGGDSTGD GGLADSDDEKISAESKVPTFEDIKEITIRGSKLAKWFMEPFFDELIVGCFVRVGIGKSRSGSVYRLCVVRNVDSTDPDRQYKLDNKTTHK | |||
Physicochemical properties | |||
Number of amino acids: | 210 | ||
Molecular weight: | 23,478.096 | ||
Theoretical pI: | 9.573 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 57.606 | ||
aromaticity | 0.052 | ||
GRAVY | -0.995 | ||
Secondary Structure Fraction | |||
Helix | 0.210 | ||
turn | 0.252 | ||
sheet | 0.219 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ190930.1 | internal | 210 | 1-630(+) |
Amino Acid sequence : | |||
YKDEDDREKLSKLTELEREMILEARATKRSDRDLTEKLKKRKGLDRKGSPPKVPTRSMRSKAERAGALDELVKRRRESAKGGSGSRYSPVKRRSFTAATLSSPSRSESGSHSDGGDSTGD GGLADSDDEKISAESKVPTFEDIKEITIRGSKLAKWFMEPFFDELIVGCFVRVGIGKSRSGSVYRLCVVRNVDSTDPDRQYKLDNKTTHK | |||
Physicochemical properties | |||
Number of amino acids: | 210 | ||
Molecular weight: | 23,478.096 | ||
Theoretical pI: | 9.573 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 57.606 | ||
aromaticity | 0.052 | ||
GRAVY | -0.995 | ||
Secondary Structure Fraction | |||
Helix | 0.210 | ||
turn | 0.252 | ||
sheet | 0.219 |