| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190930.1 | internal | 210 | 1-630(+) |
Amino Acid sequence : | |||
| YKDEDDREKLSKLTELEREMILEARATKRSDRDLTEKLKKRKGLDRKGSPPKVPTRSMRSKAERAGALDELVKRRRESAKGGSGSRYSPVKRRSFTAATLSSPSRSESGSHSDGGDSTGD GGLADSDDEKISAESKVPTFEDIKEITIRGSKLAKWFMEPFFDELIVGCFVRVGIGKSRSGSVYRLCVVRNVDSTDPDRQYKLDNKTTHK | |||
Physicochemical properties | |||
| Number of amino acids: | 210 | ||
| Molecular weight: | 23,478.096 | ||
| Theoretical pI: | 9.573 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 57.606 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.995 | ||
Secondary Structure Fraction | |||
| Helix | 0.210 | ||
| turn | 0.252 | ||
| sheet | 0.219 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190930.1 | internal | 210 | 1-630(+) |
Amino Acid sequence : | |||
| YKDEDDREKLSKLTELEREMILEARATKRSDRDLTEKLKKRKGLDRKGSPPKVPTRSMRSKAERAGALDELVKRRRESAKGGSGSRYSPVKRRSFTAATLSSPSRSESGSHSDGGDSTGD GGLADSDDEKISAESKVPTFEDIKEITIRGSKLAKWFMEPFFDELIVGCFVRVGIGKSRSGSVYRLCVVRNVDSTDPDRQYKLDNKTTHK | |||
Physicochemical properties | |||
| Number of amino acids: | 210 | ||
| Molecular weight: | 23,478.096 | ||
| Theoretical pI: | 9.573 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 57.606 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.995 | ||
Secondary Structure Fraction | |||
| Helix | 0.210 | ||
| turn | 0.252 | ||
| sheet | 0.219 | ||