Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ190933.1 | 5prime_partial | 205 | 1-618(+) |
Amino Acid sequence : | |||
TYDQCSKTGGPFGTMRFKEELAHGANNGLDIALRLLEPIRDQFPTLSFADFYQLAGVVAVEVTGGPEVPFHPGRPDKPEPPVEGRLPDATQGSDHLRQVFTKQMGLNDQDIVALSGGHTL GRCHKERSGFEGPWTTNPLIFDNSYFKELLSGEKEGLLQLPTDKTLLSDPSFRPLVEKYAADEDAFFTDYAEAHLKLSELGFADA* | |||
Physicochemical properties | |||
Number of amino acids: | 205 | ||
Molecular weight: | 22,568.955 | ||
Theoretical pI: | 4.802 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 31.332 | ||
aromaticity | 0.098 | ||
GRAVY | -0.450 | ||
Secondary Structure Fraction | |||
Helix | 0.278 | ||
turn | 0.249 | ||
sheet | 0.278 |