| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190934.1 | internal | 135 | 406-2(-) |
Amino Acid sequence : | |||
| YYPESEPGLVESDSELQAWWTEIKTVGHGDKKDEPWWPELKTPNDLIGILTTIIWIASGHHSAVNFGQFDYGAYFPNRPTTARVPMPTEEPSEEEKREFLERPEAFLMKSFPSQLQATVI MTILDVLSNHSPDEE | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 15,463.036 | ||
| Theoretical pI: | 4.526 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33460 | ||
| Instability index: | 61.831 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.594 | ||
Secondary Structure Fraction | |||
| Helix | 0.289 | ||
| turn | 0.252 | ||
| sheet | 0.274 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190934.1 | internal | 135 | 406-2(-) |
Amino Acid sequence : | |||
| YYPESEPGLVESDSELQAWWTEIKTVGHGDKKDEPWWPELKTPNDLIGILTTIIWIASGHHSAVNFGQFDYGAYFPNRPTTARVPMPTEEPSEEEKREFLERPEAFLMKSFPSQLQATVI MTILDVLSNHSPDEE | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 15,463.036 | ||
| Theoretical pI: | 4.526 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33460 | ||
| Instability index: | 61.831 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.594 | ||
Secondary Structure Fraction | |||
| Helix | 0.289 | ||
| turn | 0.252 | ||
| sheet | 0.274 | ||