| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190939.1 | internal | 171 | 3-515(+) |
Amino Acid sequence : | |||
| SIKFEQDIECGGGYIKLLSGYVNQKKFGGDTPYSLMFGPDICGPQTKKLHVILSYQGQNYPIKKDLQCETDKLTHFYTFILRPDATYSPLVDNRERESGSMYTDWDILPPRKIKDVQAKK PADWDVKEYIDGPNDVKPEGYDSIPAEIPDPKAKKPADWDEDEDGIWRPKK | |||
Physicochemical properties | |||
| Number of amino acids: | 171 | ||
| Molecular weight: | 12,862.250 | ||
| Theoretical pI: | 9.013 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33835 | ||
| Instability index: | 56.575 | ||
| aromaticity | 0.200 | ||
| GRAVY | 0.725 | ||
Secondary Structure Fraction | |||
| Helix | 0.514 | ||
| turn | 0.162 | ||
| sheet | 0.152 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190939.1 | 5prime_partial | 105 | 515-198(-) |
Amino Acid sequence : | |||
| FFWSPYSILIFIPVSRLFRFWIRYLCWYRIISLWLYVIRAVNIFFNIPICRLFCLDIFNFARWEDIPICIHTSRLSFTIVDQRTVCCIRSQNECVKMSELISFTL* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 12,862.250 | ||
| Theoretical pI: | 9.013 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33835 | ||
| Instability index: | 56.575 | ||
| aromaticity | 0.200 | ||
| GRAVY | 0.725 | ||
Secondary Structure Fraction | |||
| Helix | 0.514 | ||
| turn | 0.162 | ||
| sheet | 0.152 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190939.1 | internal | 171 | 3-515(+) |
Amino Acid sequence : | |||
| SIKFEQDIECGGGYIKLLSGYVNQKKFGGDTPYSLMFGPDICGPQTKKLHVILSYQGQNYPIKKDLQCETDKLTHFYTFILRPDATYSPLVDNRERESGSMYTDWDILPPRKIKDVQAKK PADWDVKEYIDGPNDVKPEGYDSIPAEIPDPKAKKPADWDEDEDGIWRPKK | |||
Physicochemical properties | |||
| Number of amino acids: | 171 | ||
| Molecular weight: | 12,862.250 | ||
| Theoretical pI: | 9.013 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33835 | ||
| Instability index: | 56.575 | ||
| aromaticity | 0.200 | ||
| GRAVY | 0.725 | ||
Secondary Structure Fraction | |||
| Helix | 0.514 | ||
| turn | 0.162 | ||
| sheet | 0.152 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190939.1 | 5prime_partial | 105 | 515-198(-) |
Amino Acid sequence : | |||
| FFWSPYSILIFIPVSRLFRFWIRYLCWYRIISLWLYVIRAVNIFFNIPICRLFCLDIFNFARWEDIPICIHTSRLSFTIVDQRTVCCIRSQNECVKMSELISFTL* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 12,862.250 | ||
| Theoretical pI: | 9.013 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33835 | ||
| Instability index: | 56.575 | ||
| aromaticity | 0.200 | ||
| GRAVY | 0.725 | ||
Secondary Structure Fraction | |||
| Helix | 0.514 | ||
| turn | 0.162 | ||
| sheet | 0.152 | ||