Acc_NO	ORF type	length	start-end position (strand +/-)
>JZ190948.1	5prime_partial	198	3-599(+)
Amino Acid sequence :
LVGNGVCDGVFDGNALVPFAHGMGLISDELFETVNSECNGNYYNPTDQNCENKLSEVDNAIRDLNIYDILEPCYHAPHNIITLGNTTLPSSFRRLGETERPLPVRKRIFGRAWPFRAPVR EGYVPSWPQLLNDVVQVPCTDEEVADAWLNDKAVRKALHADSVRFTFSRRFILESSETNIILAPGGFGRGLGSMHGPN*
Physicochemical properties
Number of amino acids:		198
Molecular weight:		12,258.922
Theoretical pI:		9.921
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11460 11835
Instability index:		66.730
aromaticity		0.114
GRAVY		-0.558
Secondary Structure Fraction
Helix		0.276
turn		0.276
sheet		0.124

Acc_NO	ORF type	length	start-end position (strand +/-)
>JZ190948.1	complete	106	544-224(-)
Amino Acid sequence :
MILVSLLSRMNRRENVNLTLSAWSAFLTALSFSHASATSSSVHGTWTTSFKSCGQEGTYPSLTGALKGHARPNILFLTGKGLSVSPNLLKLDGNVVFPSVIILCGA*
Physicochemical properties
Number of amino acids:		106
Molecular weight:		12,258.922
Theoretical pI:		9.921
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11460 11835
Instability index:		66.730
aromaticity		0.114
GRAVY		-0.558
Secondary Structure Fraction
Helix		0.276
turn		0.276
sheet		0.124

Acc_NO	ORF type	length	start-end position (strand +/-)
>JZ190948.1	complete	105	623-306(-)
Amino Acid sequence :
MLPASCRNLIRSVHRTQSPAKSTWCQYDISFTTFKNESPRKCKSYAVSVECLSNGFVIQPCISHFFIRARDLDYIVQKLRPRRDISFSNRSSKRPCTSEYSFPNR*
Physicochemical properties
Number of amino acids:		105
Molecular weight:		12,258.922
Theoretical pI:		9.921
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11460 11835
Instability index:		66.730
aromaticity		0.114
GRAVY		-0.558
Secondary Structure Fraction
Helix		0.276
turn		0.276
sheet		0.124