| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190956.1 | internal | 217 | 652-2(-) |
Amino Acid sequence : | |||
| TTPDAGNSDGCCLSCSRVGKFVSLRCVLALVLGVGVLLSAVFWLPIFHFRHGRDLDLDYYAGHDVVASFMLNKSTSFLSDHMWQLENDIFSEIPFASTKVEIISLNSTDPNTTKVVFAVE SDVTTQSLIRESFVNLITNESNLRLTAHLFGDPFSFDVIKFKGGITASPDQKAFLMQNEKIPFNFTLNFSIDRLLNNFNELTSQLKTGLHLTPYENL | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 17,406.220 | ||
| Theoretical pI: | 9.939 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18240 | ||
| Instability index: | 31.775 | ||
| aromaticity | 0.130 | ||
| GRAVY | 0.190 | ||
Secondary Structure Fraction | |||
| Helix | 0.370 | ||
| turn | 0.253 | ||
| sheet | 0.169 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190956.1 | 5prime_partial | 154 | 3-467(+) |
Amino Acid sequence : | |||
| KFSYGVRCKPVFSWLVSSLKLFSSRSMEKFKVKLKGIFSFCMRNAFWSGLAVIPPLNFITSNEKGSPNRCAVRRRFDSFVIRFTKDSLIKLCVVTSDSTANTTFVVFGSVEFKDIISTLV EAKGISLKISFSSCHIWSERKEVDLFSIKLATTS* | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 17,406.220 | ||
| Theoretical pI: | 9.939 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18240 | ||
| Instability index: | 31.775 | ||
| aromaticity | 0.130 | ||
| GRAVY | 0.190 | ||
Secondary Structure Fraction | |||
| Helix | 0.370 | ||
| turn | 0.253 | ||
| sheet | 0.169 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190956.1 | internal | 217 | 652-2(-) |
Amino Acid sequence : | |||
| TTPDAGNSDGCCLSCSRVGKFVSLRCVLALVLGVGVLLSAVFWLPIFHFRHGRDLDLDYYAGHDVVASFMLNKSTSFLSDHMWQLENDIFSEIPFASTKVEIISLNSTDPNTTKVVFAVE SDVTTQSLIRESFVNLITNESNLRLTAHLFGDPFSFDVIKFKGGITASPDQKAFLMQNEKIPFNFTLNFSIDRLLNNFNELTSQLKTGLHLTPYENL | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 17,406.220 | ||
| Theoretical pI: | 9.939 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18240 | ||
| Instability index: | 31.775 | ||
| aromaticity | 0.130 | ||
| GRAVY | 0.190 | ||
Secondary Structure Fraction | |||
| Helix | 0.370 | ||
| turn | 0.253 | ||
| sheet | 0.169 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190956.1 | 5prime_partial | 154 | 3-467(+) |
Amino Acid sequence : | |||
| KFSYGVRCKPVFSWLVSSLKLFSSRSMEKFKVKLKGIFSFCMRNAFWSGLAVIPPLNFITSNEKGSPNRCAVRRRFDSFVIRFTKDSLIKLCVVTSDSTANTTFVVFGSVEFKDIISTLV EAKGISLKISFSSCHIWSERKEVDLFSIKLATTS* | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 17,406.220 | ||
| Theoretical pI: | 9.939 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18240 | ||
| Instability index: | 31.775 | ||
| aromaticity | 0.130 | ||
| GRAVY | 0.190 | ||
Secondary Structure Fraction | |||
| Helix | 0.370 | ||
| turn | 0.253 | ||
| sheet | 0.169 | ||