Acc_NO	ORF type	length	start-end position (strand +/-)
>JZ190965.1	5prime_partial	137	2-415(+)
Amino Acid sequence :
RSFRITNVGVQDTTQIHTHMCYSNFNDIIHSIINMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLESNILWVNPDCGLKTRKYGEVKPALE NMVAAAKLLRSQLASAK*
Physicochemical properties
Number of amino acids:		137
Molecular weight:		11,205.011
Theoretical pI:		9.298
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15470 15470
Instability index:		62.136
aromaticity		0.110
GRAVY		0.188
Secondary Structure Fraction
Helix		0.320
turn		0.300
sheet		0.290

Acc_NO	ORF type	length	start-end position (strand +/-)
>JZ190965.1	complete	100	366-64(-)
Amino Acid sequence :
MFSRAGFTSPYLRVLRPQSGFTHKMLLSRTASILLILSAISSVDGILGEWMSYTPGPIPAPYFTPSRKTDSSFSSEREFSIVITSASMLMMEWMMSLKLE*
Physicochemical properties
Number of amino acids:		100
Molecular weight:		11,205.011
Theoretical pI:		9.298
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15470 15470
Instability index:		62.136
aromaticity		0.110
GRAVY		0.188
Secondary Structure Fraction
Helix		0.320
turn		0.300
sheet		0.290